PDB entry 3udv

View 3udv on RCSB PDB site
Description: Crystal structure of E. coli HPPK in complex with bisubstrate analogue inhibitor J1C
Class: transferase/transferase inhibitor
Keywords: Alpha Beta, Kinase, ATP Binding, Pyrophosphoryl Transfer, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-10-28, released 2012-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0142, foIK, folK, JW0138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3udva_
  • Heterogens: J1C, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3udvA (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

    Sequence, based on observed residues (ATOM records): (download) 
    >3udvA (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrerwgprtldldimlfgnevinterltvphydmknrgfm
lwplfeiapelvfpdgemlrqilhtrafdklnkw