PDB entry 3ud7

View 3ud7 on RCSB PDB site
Description: Crystal Structure Analysis of FGF1-Disaccharide(NI21) complexes
Class: hormone
Keywords: Heparin/Heparan sulfate Binding, HORMONE
Deposited on 2011-10-27, released 2012-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ud7a_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ud7b_
  • Chain 'C':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ud7c_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ud7A (A:)
    mfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikst
    etgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckr
    gprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ud7A (A:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ud7B (B:)
    mfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikst
    etgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckr
    gprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ud7B (B:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ud7C (C:)
    mfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikst
    etgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckr
    gprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ud7C (C:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv