PDB entry 3ucs

View 3ucs on RCSB PDB site
Description: Crystal structure of the complex between CBPA J-domain and CBPM
Class: chaperone
Keywords: protein-protein complex, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, co-chaperone regulation, CHAPERONE
Deposited on 2011-10-27, released 2013-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone-modulator protein CbpM
    Species: Klebsiella pneumoniae [TaxId:507522]
    Gene: cbpM, KPK_5158
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Y388 (2-End)
      • conflict (41)
  • Chain 'B':
    Compound: Chaperone-modulator protein CbpM
    Species: Klebsiella pneumoniae [TaxId:507522]
    Gene: cbpM, KPK_5158
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5Y388 (2-101)
      • conflict (41)
  • Chain 'C':
    Compound: Curved DNA-binding protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b1000, cbpA, JW0985
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36659 (2-73)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3ucsc1, d3ucsc2
  • Chain 'D':
    Compound: Curved DNA-binding protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b1000, cbpA, JW0985
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ucsd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ucsC (C:)
gselkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsde
qrraeydqmwqhrn

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3ucsD (D:)
gselkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsde
qrraeydqmwqhrn

    Sequence, based on observed residues (ATOM records): (download) 
    >3ucsD (D:)
lkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqrr
aeydqmwqh