PDB entry 3uc5

View 3uc5 on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis complexed with ATP
Class: transferase
Keywords: ppat, ATP-binding, coenzyme a biosynthesis, nucleotide-binding, nucleotidyltransferase, transferase
Deposited on 2011-10-26, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, Rv2965c, MT3043, MTCY349.22, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uc5a_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3uc5A (A:)
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln