PDB entry 3ubp

View 3ubp on RCSB PDB site
Description: diamidophosphate inhibited bacillus pasteurii urease
Class: hydrolase
Keywords: urease, bacillus pasteurii, nickel, diamidophosphate, metalloenzyme, hydrolase
Deposited on 1998-12-16, released 1999-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (urease gamma subunit)
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ubpa_
  • Chain 'B':
    Compound: protein (urease beta subunit)
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ubpb_
  • Chain 'C':
    Compound: protein (urease alpha subunit)
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • variant (18)
      • insertion (27)
      • variant (28)
      • variant (35-37)
      • variant (262)
      • variant (419)
    Domains in SCOPe 2.08: d3ubpc1, d3ubpc2
  • Heterogens: NI, 2PA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ubpA (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ubpB (B:)
    msnnnyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdra
    egigrrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakel
    gykgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubpB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ubpC (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf