PDB entry 3ubn

View 3ubn on RCSB PDB site
Description: Influenza hemagglutinin from the 2009 pandemic in complex with ligand 6SLN
Class: viral protein/immune system
Keywords: viral envelope protein, hemagglutinin, viral fusion protein, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2011-10-24, released 2011-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.207
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubna_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubnb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubnc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubnd_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubne_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubnf_
  • Chain 'G':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubng_
  • Chain 'H':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubnh_
  • Chain 'I':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubni_
  • Chain 'J':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubnj_
  • Chain 'K':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • expression tag (0-1)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubnk_
  • Chain 'L':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubnl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ubnA (A:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnA (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ubnB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ubnC (C:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnC (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpecesasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktssw
    pnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhps
    tsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfe
    atgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkc
    pkyvkstklrlatglrnip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ubnD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ubnE (E:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnE (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ubnF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ubnG (G:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnG (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpecestasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktss
    wpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhp
    stsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitf
    eatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigk
    cpkyvkstklrlatglrnips
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ubnH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ubnI (I:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnI (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktsswp
    nhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhpst
    sadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfea
    tgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcp
    kyvkstklrlatglrnips
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ubnJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ubnK (K:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnK (K:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpecsswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktsswp
    nhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhpst
    sadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfea
    tgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcp
    kyvkstklrlatglrnips
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ubnL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubnL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr