PDB entry 3ubj

View 3ubj on RCSB PDB site
Description: Influenza hemagglutinin from the 2009 pandemic in complex with ligand LSTa
Class: viral protein/immune system
Keywords: viral envelope protein, hemagglutinin, viral fusion protein, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2011-10-24, released 2011-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubja_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubjb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubjc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubjd_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • expression tag (0-1)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubje_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubjf_
  • Chain 'G':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubjg_
  • Chain 'H':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubjh_
  • Chain 'I':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubji_
  • Chain 'J':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubjj_
  • Chain 'K':
    Compound: hemagglutinin HA1
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (2-End)
      • engineered mutation (203)
      • engineered mutation (218)
    Domains in SCOPe 2.04: d3ubjk_
  • Chain 'L':
    Compound: hemagglutinin HA2
    Species: Influenza a virus [TaxId:641501]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ubjl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ubjA (A:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjA (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ubjB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ubjC (C:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjC (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpecesasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktssw
    pnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhps
    tsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfe
    atgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkc
    pkyvkstklrlatglrnips
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ubjD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ubjE (E:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjE (E:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpecsswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktsswp
    nhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhpst
    sadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfea
    tgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcp
    kyvkstklrlatglrnips
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ubjF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ubjG (G:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjG (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnips
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ubjH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ubjI (I:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjI (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpecesasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktssw
    pnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhps
    tsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfe
    atgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkc
    pkyvkstklrlatglrnips
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ubjJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ubjK (K:)
    pgdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcnia
    gwilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifp
    ktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwg
    ihhpstsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgd
    kitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpi
    tigkcpkyvkstklrlatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjK (K:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslsswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpktssw
    pnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhps
    tsadqqslyqnadtyvfvcssryskkfkpeiaicpkvrdqegrmnyywtlvepgdkitfe
    atgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkc
    pkyvkstklrlatglrnips
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ubjL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnreeidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubjL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln