PDB entry 3uai

View 3uai on RCSB PDB site
Description: Structure of the Shq1-Cbf5-Nop10-Gar1 complex from Saccharomyces cerevisiae
Class: isomerase/chaperone
Keywords: H/ACA RNP assembly intermediate, H/ACA RNA, Nuclear, ISOMERASE-CHAPERONE complex
Deposited on 2011-10-21, released 2011-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H/ACA ribonucleoprotein complex subunit 4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CBF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: H/ACA ribonucleoprotein complex subunit 3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: NOP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uaib_
  • Chain 'C':
    Compound: H/ACA ribonucleoprotein complex subunit 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GAR1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein SHQ1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SHQ1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uaiB (B:)
    mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtlkkrfglvpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uaiB (B:)
    mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.