PDB entry 3uag

View 3uag on RCSB PDB site
Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
Class: ligase
Keywords: ligase, peptidoglycan synthesis, murd, ADP-forming enzyme
Deposited on 1999-02-24, released 2000-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.178
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase)
    Species: Escherichia coli [TaxId:562]
    Gene: MURD GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14900 (0-436)
      • see remark 999 (197)
    Domains in SCOPe 2.07: d3uaga1, d3uaga2, d3uaga3
  • Heterogens: MN, UMA, ADP, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uagA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uagA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpiercvsfgvnmgdyhlnhetw
    lrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevvl
    ehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrly
    cfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrgn
    efarlakelg