PDB entry 3u9q

View 3u9q on RCSB PDB site
Description: Ligand binding domain of PPARgamma complexed with Decanoic Acid and PGC-1a peptide
Class: transcription
Keywords: Nuclear receptor, Adipogenesis, RXRa, Nucleus, TRANSCRIPTION
Deposited on 2011-10-19, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9qa_
  • Chain 'B':
    Compound: PGC-1a peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u9qA (A:)
    sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkhi
    tplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiy
    tmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaif
    iaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivt
    ehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9qA (A:)
    sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikevai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
    etdmslhpllqeiykdl
    

  • Chain 'B':
    No sequence available.