PDB entry 3u9n

View 3u9n on RCSB PDB site
Description: X-ray crystal structure of compound 1 bound to human CHK1 kinase domain
Class: transferase/transferase inhibitor
Keywords: Protein kinase domain, ATPase, ATP Binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-10-19, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9na_
  • Heterogens: 09H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u9nA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9nA (A:)
    edwdlvqtlgegaygevqlavnrvteeavavkivdenikkeicinkmlnhenvvkfyghr
    regniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpe
    nlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwsc
    givltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsari
    tipdikkdrwynkplkkg