PDB entry 3u9f

View 3u9f on RCSB PDB site
Description: Structure of CATI in complex with chloramphenicol
Class: transferase/antibiotic
Keywords: bacterial resistance, acetylation of chloramphenicol, TRANSFERASE-ANTIBIOTIC complex
Deposited on 2011-10-18, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fa_
  • Chain 'B':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fb_
  • Chain 'C':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fc_
  • Chain 'D':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fd_
  • Chain 'E':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fe_
  • Chain 'F':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9ff_
  • Chain 'G':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fg_
  • Chain 'H':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fh_
  • Chain 'I':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fi_
  • Chain 'J':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fj_
  • Chain 'K':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fk_
  • Chain 'L':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fl_
  • Chain 'M':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fm_
  • Chain 'N':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fn_
  • Chain 'O':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fo_
  • Chain 'P':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fp_
  • Chain 'R':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fr_
  • Chain 'S':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: cat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u9fs_
  • Heterogens: CLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u9fA (A:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fA (A:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u9fB (B:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fB (B:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u9fC (C:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fC (C:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u9fD (D:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fD (D:)
    gyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilarl
    mnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdvac
    ygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlmp
    laiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u9fE (E:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fE (E:)
    gyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkkfypafihilarlmnah
    pefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdvacygen
    layfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlmplaiq
    vhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3u9fF (F:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fF (F:)
    gyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilarl
    mnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdvac
    ygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlmp
    laiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3u9fG (G:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fG (G:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3u9fH (H:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fH (H:)
    itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
    rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
    acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
    mplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3u9fI (I:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fI (I:)
    itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
    rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
    acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
    mplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3u9fJ (J:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fJ (J:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3u9fK (K:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fK (K:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u9fL (L:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fL (L:)
    ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
    ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
    qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
    kvlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3u9fM (M:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fM (M:)
    gyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilarl
    mnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdvac
    ygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlmp
    laiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3u9fN (N:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fN (N:)
    tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
    lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
    cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
    plaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3u9fO (O:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fO (O:)
    gyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilarl
    mnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdvac
    ygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlmp
    laiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3u9fP (P:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fP (P:)
    kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi
    larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq
    dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk
    vlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3u9fR (R:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fR (R:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdewqg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3u9fS (S:)
    mekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafi
    hilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiy
    sqdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqg
    dkvlmplaiqvhhavcdgfhvgrmlnelqqycdewqgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u9fS (S:)
    kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
    arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
    vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
    lmplaiqvhhavcdgfhvgrmlnelqqycdewqg