PDB entry 3u8w

View 3u8w on RCSB PDB site
Description: Crystal Structure of p38a Mitogen-Activated Protein Kinase in Complex with a Triazolopyridazinone inhibitor
Class: transferase/transferase inhibitor
Keywords: Serine/Threonine Protein Kinase, Transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-10-17, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8wa_
  • Heterogens: 09J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u8wA (A:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8wA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp