PDB entry 3u8j

View 3u8j on RCSB PDB site
Description: Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3531 (1-(pyridin-3-yl)-1,4-diazepane)
Class: Acetylcholine-binding protein/agonist
Keywords: Lymnaea stagnalis, agonist, Ligand-bindig domain, Acetylcholine, Acetylcholine-binding protein, Acetylcholine-binding protein-agonist complex
Deposited on 2011-10-17, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8ja_
  • Chain 'B':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jb_
  • Chain 'C':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jc_
  • Chain 'D':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jd_
  • Chain 'E':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8je_
  • Chain 'F':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jf_
  • Chain 'G':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jg_
  • Chain 'H':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jh_
  • Chain 'I':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8ji_
  • Chain 'J':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u8jj_
  • Heterogens: 09O, SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u8jA (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jA (A:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u8jB (B:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u8jC (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jC (C:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u8jD (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jD (D:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u8jE (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jE (E:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3u8jF (F:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jF (F:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
    ccpeayedvevslnfrkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3u8jG (G:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jG (G:)
    ldradilynirqtsrpdviptqrpvavsvslkfinilevneitnevdvvfwqqttwsdrt
    lawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrfs
    cdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkns
    vtysccpeayedvevslnfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3u8jH (H:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jH (H:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
    ysccpeayedvevslnfrkk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3u8jI (I:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jI (I:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkkg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3u8jJ (J:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8jJ (J:)
    ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
    rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
    fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk