PDB entry 3u8e

View 3u8e on RCSB PDB site
Description: Crystal Structure of Cysteine Protease from Bulbs of Crocus sativus at 1.3 A Resolution
Class: hydrolase
Keywords: Papain-like Cysteine Peptidase, Peptidase_C1A, Hydrolase, Inactive form
Deposited on 2011-10-17, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.189
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Papain-like Cysteine Protease
    Species: Crocus sativus [TaxId:82528]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U8E (0-221)
    Domains in SCOPe 2.07: d3u8ea_
  • Heterogens: NA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u8eA (A:)
    apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtxx
    xxxxggdaddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssall
    davakqpvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywi
    vknswgtewgidgyilirrntnrpdgvcaidawgsyptksts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u8eA (A:)
    apasidwrkkgavtsvkdqgacgmcwafgatgaiegidaittgrlisvseqqivdcdtgg
    daddafrwvitnggiasdanypytgvdgtcdlnkpiaaridgytnvpnsssalldavakq
    pvsvniytsstsfqlytgpgifagsscsddpatvdhtvlivgygsngtnadywivknswg
    tewgidgyilirrntnrpdgvcaidawgsyptksts