PDB entry 3u85

View 3u85 on RCSB PDB site
Description: Crystal structure of human menin in complex with MLL1
Class: transcription
Keywords: menin, MEN1, MLL, JunD, LEDGF, TPR, TRANSCRIPTION, epigenetics, cancer
Deposited on 2011-10-15, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u85a1, d3u85a2
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: KMT2A, ALL1, CXXC7, HRX, HTRX, MLL, MLL1, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03164 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3u85b1, d3u85b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u85A (A:)
    sglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpe
    ltfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkk
    vsdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsed
    hawvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmv
    cainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdplt
    lyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeei
    ykeffevandvipnllkeaaslleageerpgeqsqgtqsqgsalqdpecfahllrfydgi
    ckweegsptpvlhvgwatflvqslgrfegqvrqkvrivsgtvagtargpeggstaqvpap
    taspppegpvltfqsekmkgmkellvatkinssaiklqltaqsqvqmkkqkvstpsdytl
    sflkrqrkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u85A (A:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel
    tfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkv
    sdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedh
    awvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmvc
    ainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltl
    yhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiy
    keffevandvipnllkeaaslleasalqdpecfahllrfydgickweegsptpvlhvgwa
    tflvqslgrfegqvrqkvrivsgtvagtargpvltfqsekmkgmkellvatkinssaikl
    qlta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u85B (B:)
    srwrfparpgttgggggggrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u85B (B:)
    srwrfparp