PDB entry 3u84

View 3u84 on RCSB PDB site
Description: Crystal Structure of Human Menin
Class: transcription
Keywords: menin, MEN1, MLL, JunD, LEDGF, TPR, transglutaminase-like, TRANSCRIPTION, epigenetics, cancer
Deposited on 2011-10-15, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00255 (1-458)
      • expression tag (0)
    • Uniprot O00255 (459-End)
  • Chain 'B':
    Compound: Menin
    Species: Homo sapiens [TaxId:9606]
    Gene: MEN1, SCG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u84b1, d3u84b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u84B (B:)
    sglkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpe
    ltfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkk
    vsdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsed
    hawvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrcdrkmevafmv
    cainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdplt
    lyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeei
    ykeffevandvipnllkeaaslleageerpgeqsqgtqsqgsalqdpecfahllrfydgi
    ckweegsptpvlhvgwatflvqslgrfegqvrqkvrivsgtvagtargpeggstaqvpap
    taspppegpvltfqsekmkgmkellvatkinssaiklqltaqsqvqmkkqkvstpsdytl
    sflkrqrkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u84B (B:)
    glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel
    tfqpspapdltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdvi
    wnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvv
    fgpngeqtaevtwhrrgqtvnagvaerswlylkgsymrcdrkmevafmvcainpsidlht
    dslellqlqqkllwllydlghlerypmalgnladleeleptpgrpdpltlyhkgiasakt
    yyrdehiypymylagyhcrnrnvrealqawadtatviqdynycredeeiykeffevandv
    ipnllkeaaslleasalqdpecfahllrfydgickweegsptpvlhvgwatflvqslgrf
    egqvrqkvrivsagtarggpvltfqsekmkgmkellvatkinssaiklqlta