PDB entry 3u7y

View 3u7y on RCSB PDB site
Description: Structure of NIH45-46 Fab in complex with gp120 of 93TH057 HIV
Class: viral protein/immune system
Keywords: Ig fold, gp120, anti HIV, Glycosylation, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2011-10-14, released 2011-11-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.209
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Env, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0ED31 (0-79)
      • engineered mutation (21)
      • engineered mutation (71)
      • linker (80-81)
    • Uniprot Q0ED31 (82-184)
    • Uniprot Q0ED31 (Start-352)
  • Chain 'H':
    Compound: NIH45-46 heavy chain, Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7Y (0-124)
    • Uniprot P01857 (125-End)
  • Chain 'L':
    Compound: NIH45-46 light chain, Ig kappa chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7Y (Start-103)
    • Uniprot P01834 (104-209)
    Domains in SCOPe 2.04: d3u7yl1, d3u7yl2
  • Heterogens: FLC, NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u7yL (L:)
    eivltqspatlslspgetaiiscrtsqsgslawyqqrpgqaprlviysgstraagipdrf
    sgsrwgadynlsisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u7yL (L:)
    vltqspatlslspgetaiiscrtsqsgslawyqqrpgqaprlviysgstraagipdrfsg
    srwgadynlsisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeqlk
    sgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskady
    ekhkvyacevthqglsspvtksfnrgec