PDB entry 3u7w

View 3u7w on RCSB PDB site
Description: Crystal structure of NIH45-46 Fab
Class: immune system
Keywords: Ig fold, Antibody, HIV gp120, IMMUNE SYSTEM
Deposited on 2011-10-14, released 2011-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain, Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7W (0-124)
    • Uniprot P01857 (125-228)
  • Chain 'L':
    Compound: Light chain, Ig kappa chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7W (0-103)
    • Uniprot P01834 (104-209)
    Domains in SCOPe 2.06: d3u7wl1, d3u7wl2
  • Heterogens: GOL, SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u7wL (L:)
    eivltqspatlslspgetaiiscrtsqsgslawyqqrpgqaprlviysgstraagipdrf
    sgsrwgadynlsisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec