PDB entry 3u79

View 3u79 on RCSB PDB site
Description: al-103 y32f y96f
Class: immune system
Keywords: immunoglobulin light chain variable domain, IMMUNE SYSTEM
Deposited on 2011-10-13, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.169
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-110)
    Domains in SCOPe 2.07: d3u79a_
  • Chain 'B':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-110)
    Domains in SCOPe 2.07: d3u79b_
  • Chain 'C':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-110)
    Domains in SCOPe 2.07: d3u79c_
  • Chain 'D':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-End)
    Domains in SCOPe 2.07: d3u79d_
  • Chain 'E':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-End)
    Domains in SCOPe 2.07: d3u79e_
  • Chain 'F':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-110)
    Domains in SCOPe 2.07: d3u79f_
  • Chain 'G':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-End)
    Domains in SCOPe 2.07: d3u79g_
  • Chain 'H':
    Compound: Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U79 (0-110)
    Domains in SCOPe 2.07: d3u79h_
  • Heterogens: ZN, ACT, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u79A (A:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u79B (B:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u79C (C:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u79D (D:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u79D (D:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u79E (E:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u79E (E:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u79F (F:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3u79G (G:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u79G (G:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u79H (H:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleikr