PDB entry 3u71

View 3u71 on RCSB PDB site
Description: Crystal Structure Analysis of South African wild type HIV-1 Subtype C Protease
Class: hydrolase
Keywords: Beta sheet, apo, protease, South African, non-B subtype, viral polyprotein, HYDROLASE
Deposited on 2011-10-13, released 2012-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q994Q3 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.08: d3u71a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3u71A (A:)
  pqitlwkrplvsikvggqikealldtgaddtvleeinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf