PDB entry 3u6z

View 3u6z on RCSB PDB site
Description: Crystal structure of the complex formed between type 1 ribosome inactivating protein and adenine at 1.7A resolution
Class: hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, nitrogenous base, HYDROLASE
Deposited on 2011-10-13, released 2011-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribosome inactivating protein
  Species: Momordica balsamina [TaxId:3672]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D9J2T9 (0-245)
  Domains in SCOPe 2.08: d3u6za_
• Heterogens: NAG, ADE, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3u6zA (A:)
  dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
  tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
  prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
  pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
  lntkni