PDB entry 3u6x

View 3u6x on RCSB PDB site
Description: Phage TP901-1 baseplate tripod
Class: viral protein
Keywords: helix/beta, receptor binding complex, phage tail baseplate, VIRAL PROTEIN
Deposited on 2011-10-13, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xa1, d3u6xa2, d3u6xa3
  • Chain 'B':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xb1, d3u6xb2, d3u6xb3
  • Chain 'C':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xc1, d3u6xc2, d3u6xc3
  • Chain 'D':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xd1, d3u6xd2, d3u6xd3
  • Chain 'E':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xe1, d3u6xe2, d3u6xe3
  • Chain 'F':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xf1, d3u6xf2, d3u6xf3
  • Chain 'G':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xg1, d3u6xg2, d3u6xg3
  • Chain 'H':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xh1, d3u6xh2, d3u6xh3
  • Chain 'I':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xi1, d3u6xi2, d3u6xi3
  • Chain 'J':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xj1, d3u6xj2, d3u6xj3
  • Chain 'K':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xk1, d3u6xk2, d3u6xk3
  • Chain 'L':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xl1, d3u6xl2, d3u6xl3
  • Chain 'M':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xm1, d3u6xm2, d3u6xm3
  • Chain 'N':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xn1, d3u6xn2, d3u6xn3
  • Chain 'O':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xo1, d3u6xo2, d3u6xo3
  • Chain 'P':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xp1, d3u6xp2, d3u6xp3
  • Chain 'Q':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xq1, d3u6xq2, d3u6xq3
  • Chain 'R':
    Compound: bpp
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, ORF49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.07: d3u6xr1, d3u6xr2, d3u6xr3
  • Chain 'S':
    Compound: orf48
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF48
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: orf48
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF48
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: orf48
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF48
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: orf48
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF48
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: orf48
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF48
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: orf48
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: ORF48
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u6xA (A:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xA (A:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u6xB (B:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xB (B:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u6xC (C:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xC (C:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u6xD (D:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xD (D:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u6xE (E:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xE (E:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3u6xF (F:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xF (F:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3u6xG (G:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xG (G:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3u6xH (H:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xH (H:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3u6xI (I:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xI (I:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3u6xJ (J:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xJ (J:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3u6xK (K:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xK (K:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u6xL (L:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xL (L:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3u6xM (M:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xM (M:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3u6xN (N:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xN (N:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3u6xO (O:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xO (O:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3u6xP (P:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xP (P:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3u6xQ (Q:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xQ (Q:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3u6xR (R:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6xR (R:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.