PDB entry 3u6v

View 3u6v on RCSB PDB site
Description: Crystal Structure Analysis of L23A mutant of human GST A1-1
Class: transferase
Keywords: Glutathione Transferase, thioredoxin, conserved residues, hydrophobic core, TRANSFERASE
Deposited on 2011-10-13, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered mutation (22)
    Domains in SCOPe 2.06: d3u6va1, d3u6va2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered mutation (22)
    Domains in SCOPe 2.06: d3u6vb1, d3u6vb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u6vA (A:)
    maekpklhyfnargrmestrwlaaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6vA (A:)
    aekpklhyfnargrmestrwlaaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u6vB (B:)
    maekpklhyfnargrmestrwlaaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6vB (B:)
    kpklhyfnargrmestrwlaaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmde