PDB entry 3u6r

View 3u6r on RCSB PDB site
Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 single chain FV fragment 1:7
Class: immune system
Keywords: Ig-like domain, neutralizing single chain FV, IMMUNE SYSTEM
Deposited on 2011-10-12, released 2012-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody 1:7 (Heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U6R
    Domains in SCOPe 2.04: d3u6ra_
  • Chain 'B':
    Compound: Antibody 1:7 (Light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U6R (0-End)
    Domains in SCOPe 2.04: d3u6rb_
  • Chain 'H':
    Compound: Antibody 1:7 (Heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U6R
    Domains in SCOPe 2.04: d3u6rh_
  • Chain 'L':
    Compound: Antibody 1:7 (Light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U6R (0-End)
    Domains in SCOPe 2.04: d3u6rl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u6rA (A:)
    amevqlleqsgaevkkpgssvkvscqvfgdtfsrytiqwlrqapgqgpewmgniipvynt
    pnyaqkfqgrlsitaddststaymelsslrsedtavyfcarvvipnairhtmgyyfdywg
    qgtlvtvssgtggsggggsggggsgggas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6rA (A:)
    mevqlleqsgaevkkpgssvkvscqvfgdtfsrytiqwlrqapgqgpewmgniipvyntp
    nyaqkfqgrlsitaddststaymelsslrsedtavyfcarvvipnairhtmgyyfdywgq
    gtlvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u6rB (B:)
    aeltqspatlslspgeratlscrasqsvnkylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisnlepedfavyycqqrsdwvtfgggtkveikaaaddddkagwshpq
    fekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6rB (B:)
    aeltqspatlslspgeratlscrasqsvnkylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisnlepedfavyycqqrsdwvtfgggtkveik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3u6rH (H:)
    amevqlleqsgaevkkpgssvkvscqvfgdtfsrytiqwlrqapgqgpewmgniipvynt
    pnyaqkfqgrlsitaddststaymelsslrsedtavyfcarvvipnairhtmgyyfdywg
    qgtlvtvssgtggsggggsggggsgggas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6rH (H:)
    evqlleqsgaevkkpgssvkvscqvfgdtfsrytiqwlrqapgqgpewmgniipvyntpn
    yaqkfqgrlsitaddststaymelsslrsedtavyfcarvvipnairhtmgyyfdywgqg
    tlvtvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u6rL (L:)
    aeltqspatlslspgeratlscrasqsvnkylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisnlepedfavyycqqrsdwvtfgggtkveikaaaddddkagwshpq
    fekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6rL (L:)
    aeltqspatlslspgeratlscrasqsvnkylawyqqkpgqaprlliydasnratgipar
    fsgsgsgtdftltisnlepedfavyycqqrsdwvtfgggtkveik