PDB entry 3u6j

View 3u6j on RCSB PDB site
Description: Crystal structure of the VEGFR2 kinase domain in complex with a pyrazolone inhibitor
Class: transferase/transferase inhibitor
Keywords: KDR, Flk-1, angiogenesis, phosphotransferase, cancer, vascular endothelial growth factor, TRANSFERASE/TRANSFERASE INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-10-12, released 2012-02-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FLK1, KDR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (0-306)
      • engineered mutation (101)
      • engineered mutation (125)
      • expression tag (307-309)
    Domains in SCOPe 2.05: d3u6ja_
  • Heterogens: 03X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u6jA (A:)
    ehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkega
    thsehralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrne
    fvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvki
    cdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgas
    pypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnll
    qanaqqdrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6jA (A:)
    ehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidatcrtvavkmlkegath
    sehralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefv
    pykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicd
    fglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspy
    pgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqa
    naqqdrhh