PDB entry 3u6h

View 3u6h on RCSB PDB site
Description: Crystal structure of c-Met in complex with pyrazolone inhibitor 26
Class: transferase/transferase inhibitor
Keywords: kinase domain, phosphotransferase, cancer, hepatocyte growth factor, HGF, transferase-transferase inhibitor complex
Deposited on 2011-10-12, released 2012-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u6ha_
  • Heterogens: 03X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u6hA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u6hA (A:)
    vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk
    slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir
    nethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgpvkwma
    leslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdp
    lyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh