PDB entry 3u4x

View 3u4x on RCSB PDB site
Description: Crystal structure of a lectin from Camptosema pedicellatum seeds in complex with 5-bromo-4-chloro-3-indolyl-alpha-D-mannose
Class: carbohydrate-binding protein
Keywords: jelly-roll domain, lectin, carbohydrate-binding protein
Deposited on 2011-10-10, released 2012-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Camptosema pedicellatum lectin (CPL)
  Species: Camptosema pedicellatum [TaxId:232302]
  Database cross-references and differences (RAF-indexed):
  • PDB 3U4X (0-235)
  Domains in SCOPe 2.08: d3u4xa_
• Heterogens: CA, MN, XMM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3u4xA (A:)
  adtivaveldtypntdigdpnyqhiginiksirskattrwnvqdgkvgtahisynsvakr
  lsaivsypggssatvsydvdlnnilpewvrvglsastgvyketntilswsftsklktnst
  adaqslhftfnqfsqspkdlilqgdastdsdgnlqltrvsngspqsnsvgralyyapvhv
  wdksavvasfdatftflikspdsdpadgiaffiantdssiphgsggrllglfpdan