PDB entry 3u4e

View 3u4e on RCSB PDB site
Description: Crystal Structure of PG9 Fab in Complex with V1V2 Region from HIV-1 strain CAP45
Class: immune system
Keywords: neutralizing antibodies, long cdrh3, hiv-1, immune system
Deposited on 2011-10-07, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.184
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PG9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4E (0-End)
  • Chain 'B':
    Compound: PG9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4E
    Domains in SCOPe 2.07: d3u4eb1, d3u4eb2
  • Chain 'G':
    Compound: V1V2 region of HIV-1 on 1FD6 scaffold
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4E (0-End)
  • Chain 'H':
    Compound: PG9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4E (0-End)
  • Chain 'J':
    Compound: V1V2 region of HIV-1 on 1FD6 scaffold
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4E
  • Chain 'L':
    Compound: PG9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4E (0-End)
    Domains in SCOPe 2.07: d3u4el1, d3u4el2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u4eB (B:)
    qsaltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgv
    snrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4eB (B:)
    saltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgvs
    nrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u4eL (L:)
    qsaltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgv
    snrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4eL (L:)
    qsaltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgv
    snrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapte