PDB entry 3u4c

View 3u4c on RCSB PDB site
Description: Crystal structure of YwfH, NADPH dependent reductase involved in Bacilysin biosynthesis
Class: oxidoreductase
Keywords: NADPH binding motif, Rossmann fold, SDR superfamily, Oxidoreductase, Bacilysin biosynthesis
Deposited on 2011-10-07, released 2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacilysin biosynthesis oxidoreductase ywfH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37680, ipa-86r, ywfH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3u4ca_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u4cA (A:)
    mgsshhhhhhssglvprgshmskrtafvmgasqgigkaialkladqhfslvinsrnldni
    esvkedilakhpeasvivlagdmsdqhtragifqkiesqcgrldvlinnipggapdtfdn
    cniedmtatftqktvayidaikrasslmkqnefgriinivgnlwkepganmftnsmmnaa
    linasknisiqlaphnitvnclnpgfiatdryhqfvenvmkknsiskqkaeeqiasgipm
    krvgsaeetaalaaflaseeasyitgqqisadggsmksile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4cA (A:)
    skrtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlag
    dmsdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidai
    krasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvnc
    lnpgfiatdryhqfvenvmkknqkaeeqiasgipmkrvgsaeetaalaaflaseeasyit
    gqqisadggsmksi