PDB entry 3u4b

View 3u4b on RCSB PDB site
Description: CH04H/CH02L Fab P4
Class: immune system
Keywords: IGG, Immunoglobulin, Immune system, HIV-1, V1V2-directed
Deposited on 2011-10-07, released 2011-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.224
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CH04 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4B (0-End)
  • Chain 'L':
    Compound: CH02 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U4B (0-End)
    Domains in SCOPe 2.04: d3u4bl1, d3u4bl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u4bL (L:)
    eivltqspatlsvspgeratlscrasqnvhpryfawyqqkrgqsprllihsgstraagia
    drfsgggsgmhftltitrvepedfavyfcqqyggspytfgqgtrvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u4bL (L:)
    eivltqspatlsvspgeratlscrasqnvhpryfawyqqkrgqsprllihsgstraagia
    drfsgggsgmhftltitrvepedfavyfcqqyggspytfgqgtrvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge