PDB entry 3u46

View 3u46 on RCSB PDB site
Description: ch04h/ch02l p212121
Class: immune system
Keywords: IGG, Immunogloblulin, Immune system, HIV-1 Antibodies, V1V2-Directed
Deposited on 2011-10-07, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.216
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CH04 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U46 (0-End)
  • Chain 'B':
    Compound: CH02 Light chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U46 (0-End)
    Domains in SCOPe 2.07: d3u46b1, d3u46b2
  • Chain 'H':
    Compound: CH04 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U46 (0-End)
  • Chain 'L':
    Compound: CH02 Light chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U46 (0-End)
    Domains in SCOPe 2.07: d3u46l1, d3u46l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u46B (B:)
    eivltqspatlsvspgeratlscrasqnvhpryfawyqqkrgqsprllihsgstraagia
    drfsgggsgmhftltitrvepedfavyfcqqyggspytfgqgtrvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u46B (B:)
    eivltqspatlsvspgeratlscrasqnvhpryfawyqqkrgqsprllihsgstraagia
    drfsgggsgmhftltitrvepedfavyfcqqyggspytfgqgtrvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u46L (L:)
    eivltqspatlsvspgeratlscrasqnvhpryfawyqqkrgqsprllihsgstraagia
    drfsgggsgmhftltitrvepedfavyfcqqyggspytfgqgtrvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u46L (L:)
    eivltqspatlsvspgeratlscrasqnvhpryfawyqqkrgqsprllihsgstraagia
    drfsgggsgmhftltitrvepedfavyfcqqyggspytfgqgtrvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge