PDB entry 3u3r

View 3u3r on RCSB PDB site
Description: Crystal structure of D249G mutated Human SULT1A1 bound to PAP and P-NITROPHENOL
Class: transferase
Keywords: Arylsulfotransferase, PAP, P-NITROPHENOL, Xenobiotics, TRANSFERASE
Deposited on 2011-10-06, released 2011-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.17
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: hSULT1A1 D249G mutation, OK/SW-cl.88, STP, STP1, SULT1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-314)
      • see remark 999 (232)
      • see remark 999 (242)
      • engineered mutation (268)
    Domains in SCOPe 2.06: d3u3ra_
  • Heterogens: NPO, A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u3rA (A:)
    mgsshhhhhhssglvprgshmeliqdtsrppleyvkgvplikyfaealgplqsfqarpdd
    llistypksgttwvsqildmiyqggdlekchrapifmrvpflefkapgipsgmetlkdtp
    aprllkthlplallpqtlldqkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsfle
    kfmvgevsygswyqhvqewwelsrthpvlylfyedmkenpkreiqkilefvghslpeetv
    dfmvqhtsfkemkknpmtnyttvpqefmghsispfmrkgmagdwkttftvaqnerfdady
    aekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u3rA (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mghsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel