PDB entry 3u3j

View 3u3j on RCSB PDB site
Description: Crystal structure of hSULT1A1 bound to PAP
Class: transferase
Keywords: Arylsulfotransferase, TRANSFERASE
Deposited on 2011-10-06, released 2011-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: hSULT1A1, OK/SW-cl.88, STP, STP1, SULT1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-313)
      • see remark 999 (232)
      • see remark 999 (242)
    Domains in SCOPe 2.06: d3u3ja_
  • Chain 'B':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: hSULT1A1, OK/SW-cl.88, STP, STP1, SULT1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-313)
      • see remark 999 (232)
      • see remark 999 (242)
    Domains in SCOPe 2.06: d3u3jb_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u3jA (A:)
    mgsshhhhhhssglvprgshmeliqdtsrppleyvkgvplikyfaealgplqsfqarpdd
    llistypksgttwvsqildmiyqggdlekchrapifmrvpflefkapgipsgmetlkdtp
    aprllkthlplallpqtlldqkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsfle
    kfmvgevsygswyqhvqewwelsrthpvlylfyedmkenpkreiqkilefvghslpeetv
    dfmvqhtsfkemkknpmtnyttvpqefmdhsispfmrkgmagdwkttftvaqnerfdady
    aekmagcslsfrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u3jA (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u3jB (B:)
    mgsshhhhhhssglvprgshmeliqdtsrppleyvkgvplikyfaealgplqsfqarpdd
    llistypksgttwvsqildmiyqggdlekchrapifmrvpflefkapgipsgmetlkdtp
    aprllkthlplallpqtlldqkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsfle
    kfmvgevsygswyqhvqewwelsrthpvlylfyedmkenpkreiqkilefvghslpeetv
    dfmvqhtsfkemkknpmtnyttvpqefmdhsispfmrkgmagdwkttftvaqnerfdady
    aekmagcslsfrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u3jB (B:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrse