PDB entry 3u3e

View 3u3e on RCSB PDB site
Description: Complex of Wild Type Myoglobin with Phenol in its Proximal Cavity
Class: oxygen transport
Keywords: Heme containing, Oxygen transport, Phenol Binding
Deposited on 2011-10-05, released 2012-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.145
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3u3ea_
  • Heterogens: HEM, IPH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u3eA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u3eA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg