PDB entry 3u30

View 3u30 on RCSB PDB site
Description: Crystal structure of a linear-specific Ubiquitin fab bound to linear ubiquitin
Class: immune system
Keywords: immune system
Deposited on 2011-10-04, released 2012-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: linear di-ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (20-End)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d3u30a1, d3u30a2, d3u30a3
  • Chain 'B':
    Compound: Light chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U30 (0-End)
    Domains in SCOPe 2.07: d3u30b1, d3u30b2
  • Chain 'C':
    Compound: Heavy chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U30
  • Chain 'D':
    Compound: linear di-ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u30d1, d3u30d2
  • Chain 'E':
    Compound: Light chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U30 (0-End)
    Domains in SCOPe 2.07: d3u30e1, d3u30e2
  • Chain 'F':
    Compound: Heavy chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U30
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u30A (A:)
    mgsshhhhhhssglvprgshmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtie
    nvkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u30A (A:)
    shmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqr
    lifagkqledgrtlsdyniqkestlhlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u30B (B:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysakflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u30B (B:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysakflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u30D (D:)
    mgsshhhhhhssglvprgshmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtie
    nvkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u30D (D:)
    qifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyni
    qkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlif
    agkqledgrtlsdyniqkestlhlv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u30E (E:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysakflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u30E (E:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysakflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'F':
    No sequence available.