PDB entry 3u2s

View 3u2s on RCSB PDB site
Description: Crystal Structure of PG9 Fab in Complex with V1V2 Region from HIV-1 strain ZM109
Class: immune system
Keywords: greek key, immunoglobulin, immune recognition, IMMUNE SYSTEM
Deposited on 2011-10-04, released 2011-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PG9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U2S (0-End)
  • Chain 'B':
    Compound: PG9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U2S
    Domains in SCOPe 2.04: d3u2sb1, d3u2sb2
  • Chain 'C':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 3U2S
  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 3U2S
  • Chain 'H':
    Compound: PG9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U2S (0-End)
  • Chain 'L':
    Compound: PG9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U2S
    Domains in SCOPe 2.04: d3u2sl1, d3u2sl2
  • Heterogens: SO4, BU3, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u2sB (B:)
    qsaltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgv
    snrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2sB (B:)
    saltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgvs
    nrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvap
    

  • Chain 'C':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u2sL (L:)
    qsaltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgv
    snrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2sL (L:)
    saltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgvs
    nrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvap