PDB entry 3u2j

View 3u2j on RCSB PDB site
Description: Neutron crystal structure of human Transthyretin
Class: transport protein
Keywords: transporter, Thyroxine Binding, TRANSPORT PROTEIN
Deposited on 2011-10-03, released 2012-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NEUT
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d3u2ja_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d3u2jb_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u2jA (A:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2jA (A:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u2jB (B:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2jB (B:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftaprrytiaallspysysttavvtn