PDB entry 3u2i

View 3u2i on RCSB PDB site
Description: X-ray crystal structure of human Transthyretin at room temperature
Class: transport protein
Keywords: transporter, Thyroxine Binding, TRANSPORT PROTEIN
Deposited on 2011-10-03, released 2012-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3u2ia1, d3u2ia2
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3u2ib1, d3u2ib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u2iA (A:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2iA (A:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u2iB (B:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u2iB (B:)
    mlmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn