PDB entry 3u2b

View 3u2b on RCSB PDB site
Description: Structure of the Sox4 HMG domain bound to DNA
Class: transcription/DNA
Keywords: HMG domain, transcriptional regulation, TRANSCRIPTION-DNA complex
Deposited on 2011-10-03, released 2011-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*gp*tp*cp*tp*cp*tp*ap*tp*tp*gp*tp*cp*cp*tp*gp*g)-3')
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: DNA (5'-d(*cp*cp*ap*gp*gp*ap*cp*ap*ap*tp*ap*gp*ap*gp*ap*c)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: Transcription factor SOX-4
    Species: Mus musculus [TaxId:10090]
    Gene: Sox4, Sox-4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3u2bc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3u2bC (C:)
ghikrpmnafmvwsqierrkimeqspdmhnaeiskrlgkrwkllkdsdkipfiqeaerlr
lkhmadypdykyrprkkvk

    Sequence, based on observed residues (ATOM records): (download) 
    >3u2bC (C:)
ghikrpmnafmvwsqierrkimeqspdmhnaeiskrlgkrwkllkdsdkipfiqeaerlr
lkhmadypdykyrprk