PDB entry 3u28

View 3u28 on RCSB PDB site
Description: Crystal structure of a Cbf5-Nop10-Gar1 complex from Saccharomyces cerevisiae
Class: isomerase/protein binding
Keywords: pseudouridine synthase, pseudouridylation, H/ACA RNA, Nucleolus, ISOMERASE-PROTEIN BINDING complex
Deposited on 2011-10-02, released 2011-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H/ACA ribonucleoprotein complex subunit 4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CBF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: H/ACA ribonucleoprotein complex subunit 3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: NOP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3u28b_
  • Chain 'C':
    Compound: H/ACA ribonucleoprotein complex subunit 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GAR1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u28B (B:)
    mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtlkkrfglvpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u28B (B:)
    mhlmytlgpdgkriytlkkvtesgeitksahparfspddkysrqrvtl
    

  • Chain 'C':
    No sequence available.