PDB entry 3u1u

View 3u1u on RCSB PDB site
Description: Crystal structure of RNA polymerase-associated protein RTF1 homolog Plus-3 domain
Class: transcription
Keywords: PLUS-3, transcription elongation, Structural Genomics, Structural Genomics Consortium, SGC, transcription
Deposited on 2011-09-30, released 2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase-associated protein RTF1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: RTF1, KIAA0252
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u1ua_
  • Chain 'B':
    Compound: RNA polymerase-associated protein RTF1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: RTF1, KIAA0252
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3u1ub_
  • Heterogens: SO4, GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u1uA (A:)
    gppksqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaei
    tgvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmq
    lptldeinkkelsikea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u1uA (A:)
    pksqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignpvyrvaeitgvvet
    akvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptlde
    inkkelsikea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u1uB (B:)
    gppksqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaei
    tgvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmq
    lptldeinkkelsikea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u1uB (B:)
    sqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignpvyrvaeitgvvetak
    vyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldein
    kkelsikea