PDB entry 3u1s

View 3u1s on RCSB PDB site
Description: Crystal structure of human Fab PGT145, a broadly reactive and potent HIV-1 neutralizing antibody
Class: immune system
Keywords: IgG, broadly neutralizing antibody, HIV-1 gp120, IMMUNE SYSTEM
Deposited on 2011-09-30, released 2011-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab PGT145 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U1S
  • Chain 'L':
    Compound: Fab PGT145 Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U1S
    Domains in SCOPe 2.06: d3u1sl1, d3u1sl2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u1sL (L:)
    mrlpaqllgllmlwvsgsgaevvitqsplflpvtpgeaaslsckcshslqhstganylaw
    ylqrpgqtprllihlathrasgvpdrfsgsgsgtdftlkisrvesddvgtyycmqglhsp
    wtfgqgtkveikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalq
    sgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u1sL (L:)
    vvitqsplflpvtpgeaaslsckcshslqhstganylawylqrpgqtprllihlathras
    gvpdrfsgsgsgtdftlkisrvesddvgtyycmqglhspwtfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge