PDB entry 3u1h

View 3u1h on RCSB PDB site
Description: Crystal structure of IPMDH from the last common ancestor of Bacillus
Class: oxidoreductase
Keywords: isocitrate/isopropylmalate dehydrogenase-like fold, OXIDOREDUCTASE
Deposited on 2011-09-29, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus sp. [TaxId:1409]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • PDB 3U1H
    Domains in SCOPe 2.07: d3u1ha_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus sp. [TaxId:1409]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • PDB 3U1H
    Domains in SCOPe 2.07: d3u1hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u1hA (A:)
    hhhhhhdydipttenlyfqgamkkkiavlpgdgigpevmeaaievlkavaerfghefefe
    ygliggaaideagtplpeetldvcrgsdaillgavggpkwdqnpselrpekgllgirkgl
    dlfanlrpvkvydsladasplkkeviegvdlvivreltgglyfgepseryeegeeaavdt
    llytreeieriirkafelaltrkkkvtsvdkanvlessrlwrevaeevakeypdvelehm
    lvdnaamqlirnprqfdvivtenmfgdilsdeasmitgslgmlpsaslstdglglyepvh
    gsapdiagkgianplatilsaammlrysfgleeeakaiekavekvlaegyrtadiakpgg
    kyvsttemtdevkaavvdelatsaimtayv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u1hA (A:)
    kkiavlpgdgigpevmeaaievlkavaerfghefefeygliggaaideagtplpeetldv
    crgsdaillgavggpkwdqnpselrpekgllgirkgldlfanlrpvkvydsladasplkk
    eviegvdlvivreltgglyfeegeeaavdtllytreeieriirkafelaltrkkkvtsvd
    kanvlessrlwrevaeevakeypdvelehmlvdnaamqlirnprqfdvivtenmfgdils
    deasmitgslgmlpsaslstdglglyepvhgsapdiagkgianplatilsaammlrysfg
    leeeakaiekavekvlaegyrtadiakpggkyvsttemtdevkaavvdelatsai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u1hB (B:)
    hhhhhhdydipttenlyfqgamkkkiavlpgdgigpevmeaaievlkavaerfghefefe
    ygliggaaideagtplpeetldvcrgsdaillgavggpkwdqnpselrpekgllgirkgl
    dlfanlrpvkvydsladasplkkeviegvdlvivreltgglyfgepseryeegeeaavdt
    llytreeieriirkafelaltrkkkvtsvdkanvlessrlwrevaeevakeypdvelehm
    lvdnaamqlirnprqfdvivtenmfgdilsdeasmitgslgmlpsaslstdglglyepvh
    gsapdiagkgianplatilsaammlrysfgleeeakaiekavekvlaegyrtadiakpgg
    kyvsttemtdevkaavvdelatsaimtayv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u1hB (B:)
    kkkiavlpgdgigpevmeaaievlkavaerfghefefeygliggaaideagtplpeetld
    vcrgsdaillgavggpkwdqnpselrpekgllgirkgldlfanlrpvkvydsladasplk
    keviegvdlvivreltgglyeegeeaavdtllytreeieriirkafelaltrkkkvtsvd
    kanvlessrlwrevaeevakeypdvelehmlvdnaamqlirnprqfdvivtenmfgdils
    deasmitgslgmlpsaslstdglglyepvhgsapdiagkgianplatilsaammlrysfg
    leeeakaiekavekvlaegyrtadiakpggkyvsttemtdevkaavvdelatsaimt