PDB entry 3u0z

View 3u0z on RCSB PDB site
Description: Tetramerization dynamics of the C-terminus underlies isoform-specific cAMP-gating in HCN channels
Class: transport protein
Keywords: helix, beta sheet, TRANSPORT PROTEIN, cNMP binding
Deposited on 2011-09-29, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1
    Species: Mus musculus [TaxId:10090]
    Gene: Hcn1, Bcng1, Hac2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0za_
  • Chain 'B':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1
    Species: Mus musculus [TaxId:10090]
    Gene: Hcn1, Bcng1, Hac2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u0zb_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u0zA (A:)
    qgpsspmdssrrqyqekykqveqymsfhklpadmrqkihdyyehryqgkifdeenilsel
    ndplreeivnfncrklvatmplfanadpnfvtamlsklrfevfqpgdyiiregavgkkmy
    fiqhgvagvitksskemkltdgsyfgeiclltkgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetvaidrldrigkknsillq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0zA (A:)
    dssrrqyqekykqveqymsfhklpadmrqkihdyyehryqgkifdeenilselndplree
    ivnfncrklvatmplfanadpnfvtamlsklrfevfqpgdyiiregavgkkmyfiqhgva
    gvitksskemkltdgsyfgeiclltkgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaidrldrigkkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u0zB (B:)
    qgpsspmdssrrqyqekykqveqymsfhklpadmrqkihdyyehryqgkifdeenilsel
    ndplreeivnfncrklvatmplfanadpnfvtamlsklrfevfqpgdyiiregavgkkmy
    fiqhgvagvitksskemkltdgsyfgeiclltkgrrtasvradtycrlyslsvdnfnevl
    eeypmmrrafetvaidrldrigkknsillq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0zB (B:)
    dssrrqyqekykqveqymsfhklpadmrqkihdyyehryqgkifdeenilselndplree
    ivnfncrklvatmplfanadpnfvtamlsklrfevfqpgdyiiregavgkkmyfiqhgva
    gvitksskemkltdgsyfgeiclltkgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaidrldrigkkns