PDB entry 3u0w

View 3u0w on RCSB PDB site
Description: AD related murine antibody Fragment
Class: immune system
Keywords: immunoglobulin, antibody, amyloid beta, Alzheimer, IMMUNE SYSTEM
Deposited on 2011-09-29, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab Heavy Chain, Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3U0W (0-112)
    • Uniprot P01857 (113-End)
  • Chain 'L':
    Compound: Fab Light Chain, Ig kappa chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3U0W (0-107)
    • Uniprot P01834 (108-End)
    Domains in SCOPe 2.07: d3u0wl1, d3u0wl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3u0wL (L:)
    diqmtqttsslsaslgdrvtiscsasqgisnylnwfqqkpdgtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyrklpytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u0wL (L:)
    diqmtqttsslsaslgdrvtiscsasqgisnylnwfqqkpdgtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyrklpytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge