PDB entry 3u09

View 3u09 on RCSB PDB site
Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG)(G92D) from Vibrio cholerae
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, Vibrio cholerae, 3-ketoacyl-(acyl-carrier-protein) reductase, FabG, OXIDOREDUCTASE
Deposited on 2011-09-28, released 2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: Vibrio cholerae [TaxId:243277]
    Gene: fabG, VC2021, VC_2021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQH7 (7-250)
      • expression tag (3-6)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d3u09a1, d3u09a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: Vibrio cholerae [TaxId:243277]
    Gene: fabG, VC2021, VC_2021
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQH7 (7-250)
      • expression tag (3-6)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d3u09b1, d3u09b2
  • Heterogens: SO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u09A (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnaditrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u09A (A:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnaditrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u09B (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnaditrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u09B (B:)
    msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgm
    alnvtnpesieavlkaitdefggvdilvnnaditrdnllmrmkeeewsdimetnltsifr
    lskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtv
    ntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlh
    vnggmymi