PDB entry 3u01

View 3u01 on RCSB PDB site
Description: Crystal structure of onconase double mutant C30A/C75A at 1.12 A resolution
Class: hydrolase, antitumor protein
Keywords: alpha/beta protein, ranpirnase, endonuclease, nuclease, HYDROLASE, ANTITUMOR PROTEIN
Deposited on 2011-09-28, released 2011-12-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.137
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein P-30
    Species: Rana pipiens [TaxId:8404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22069 (0-103)
      • engineered mutation (29)
      • engineered mutation (74)
    Domains in SCOPe 2.05: d3u01a_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u01A (A:)
    edwltfqkkhitntrdvdcdnimstnlfhakdkntfiysrpepvkaickgiiasknvltt
    sefylsdcnvtsrpakyklkkstnkfcvtcenqapvhfvgvgsc