PDB entry 3u00

View 3u00 on RCSB PDB site
Description: Crystal structure of wild-type onconase at 1.65 A resolution
Class: hydrolase, antitumor protein
Keywords: alpha/beta protein, ranpirnase, endonuclease, nuclease, HYDROLASE, ANTITUMOR PROTEIN
Deposited on 2011-09-28, released 2011-12-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.177
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein P-30
  Species: Rana pipiens [TaxId:8404]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22069 (0-103)
  Domains in SCOPe 2.03: d3u00a_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3u00A (A:)
  edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
  sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc