PDB entry 3tzn

View 3tzn on RCSB PDB site
Description: Crystal Structure of the Yersinia pestis Dihydropteroate synthase.
Class: transferase
Keywords: Dihydropteroate synthase, Tim barrel, transferase
Deposited on 2011-09-27, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CKJ1 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3tzna1, d3tzna2
  • Chain 'B':
    Compound: 7,8-dihydropteroate synthase
    Species: Yersinia pestis [TaxId:632]
    Gene: dhpS, folP, y0683, YPO3501, YP_0582
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tznb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tznA (A:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tznA (A:)
    shmhltargltldlsrpqvmgilnnldqalqhaqrmlsagatlidiggeldrvvpvveal
    aqrfdvwlsvdtskaavitesahagahlindirslqepgaleaaaktglpvclmhmqhsp
    yyddlmtdinrffqhhiercvaagiaknkllldpgfgfgknlahnyqllahlselhhfel
    pllvgmsrksmvgqllnvppqqrvigsvacaviaamqgaqiirvhdvketveamciveat
    rsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tznB (B:)
    gshmhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidi
    ggestrpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindi
    rslqepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagi
    aknkllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvi
    gsvacaviaamqgaqiirvhdvketveamciveatrsakg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tznB (B:)
    mhltargltldlsrpqvmgilnnldqalqhaqrmlsagatlidirvvpvvealaqrfdvw
    lsvdtskaavitesahagahlindiglpvclmhlmtdinrffqhhiercvaagiaknkll
    ldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsvaca
    viaamqgaqiirvhdvketveamciveatrsa